PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00014732-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family M-type_MADS
Protein Properties Length: 70aa    MW: 7924.05 Da    PI: 10.5411
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00014732-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.65.3e-31959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krienk+nrqvtfskRr g+lKKA+E+SvLCdaev +i+fs++gkl+eys+
  WALNUT_00014732-RA  9 KRIENKINRQVTFSKRRGGLLKKAHEISVLCDAEVGLIVFSNKGKLFEYST 59
                        79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.071161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.71E-30263IPR002100Transcription factor, MADS-box
CDDcd002653.33E-35259No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-32323IPR002100Transcription factor, MADS-box
PfamPF003193.9E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-323859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 70 aa     Download sequence    Send to blast
MGRGRVQLKR IENKINRQVT FSKRRGGLLK KAHEISVLCD AEVGLIVFSN KGKLFEYSTD  60
SWYSSTSDSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D2e-20260160Myocyte-specific enhancer factor 2A
3mu6_C2e-20260160Myocyte-specific enhancer factor 2A
3mu6_B2e-20260160Myocyte-specific enhancer factor 2A
3mu6_A2e-20260160Myocyte-specific enhancer factor 2A
1tqe_S2e-20160161Myocyte-specific enhancer factor 2B
1tqe_R2e-20160161Myocyte-specific enhancer factor 2B
1tqe_Q2e-20160161Myocyte-specific enhancer factor 2B
1tqe_P2e-20160161Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007156376.19e-36hypothetical protein PHAVU_003G2810000g, partial
RefseqXP_009625854.13e-35PREDICTED: agamous-like MADS-box protein AGL8 homolog
RefseqXP_016451215.13e-35PREDICTED: agamous-like MADS-box protein AGL8 homolog
SwissprotO223281e-36AGL8_SOLCO; Agamous-like MADS-box protein AGL8 homolog
TrEMBLA0A0V0H9191e-37A0A0V0H919_SOLCH; Putative agamous-like MADS-box protein AGL8-like
STRINGPGSC0003DMT4000633131e-34(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.19e-33AGAMOUS-like 8